10mg · Lyophilized
Human cathelicidin antimicrobial peptide LL-37, ≥95% (HPLC), lyophilised. Reference standard for innate immunity and membrane-disruption research. Research use only — not for human or veterinary consumption.
Every vial is linked to its own certificate of analysis — download the exact document for this batch before you order.
Certificate not yet uploaded.The certificate of analysis for this product has not been uploaded yet.
| Field | Value |
|---|---|
| Product Name | LL-37 |
| Catalogue Number | CAC-LL37-10MG |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.34 g/mol |
| Sequence | [LL-37, 37 aa] |
| Form | Lyophilised White Powder (TFA salt) |
Orders placed before 2 PM EST ship the same business day in insulated cold-chain packaging with gel packs. Most US orders arrive within 1–3 business days with tracking. All shipments include temperature indicators to confirm cold-chain integrity on arrival.
This website and its products are intended strictly for laboratory research use by qualified professionals. All products are sold for in-vitro research only — not for human or animal consumption, diagnostic, or therapeutic use. By entering, you confirm you are at least 18 years of age and agree to these terms.
You must confirm you are 18 years of age or older, and that these products are for research purposes only, to access this site.
